Recombinant Human ENOX1, His-tagged
Cat.No. : | ENOX1-28568TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 269-643 of Human ENOX1 with an N terminal His tag; Predicted MWt 45 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Description : | Electron transport pathways are generally associated with mitochondrial membranes, but non-mitochondrial pathways are also biologically significant. Plasma membrane electron transport pathways are involved in functions as diverse as cellular defense, intracellular redox homeostasis, and control of cell growth and survival. Members of the ecto-NOX family, such as CNOX, or ENOX1, are involved in plasma membrane transport pathways. These enzymes exhibit both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity in series, with each activity cycling every 22 to 26 minutes (Scarlett et al. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 88 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LAEKLKDDSKFSEAITVLLSWIERGEVNRRSANQFYSMVQ SANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQF EQIVAVFNASTRQKAWDHFSKAQRKNIDIWRKHSEELR NAQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDESAL AAQAYALKEENDSLRWQLDAYRNEVELLKQEKEQLFRTEE NLTKDQQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQ AKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNE INVLTVALVNQDRENNIEKRSQGLKSEKEALLIGIIST FLHVHPFGANIEYLWSYMQQLDSKISANEIEMLLMRLP RMFKQEFTGVGATLEKRWKLCAFEGIKTT |
Gene Name : | ENOX1 ecto-NOX disulfide-thiol exchanger 1 [ Homo sapiens ] |
Official Symbol : | ENOX1 |
Synonyms : | ENOX1; ecto-NOX disulfide-thiol exchanger 1; cCNOX; CNOX; FLJ10094; PIG38; |
Gene ID : | 55068 |
mRNA Refseq : | NM_017993 |
Protein Refseq : | NP_060463 |
MIM : | 610914 |
Uniprot ID : | Q8TC92 |
Chromosome Location : | 13q14.11 |
Function : | nucleic acid binding; nucleotide binding; oxidoreductase activity; |
Products Types
◆ Recombinant Protein | ||
ENOX1-2796M | Recombinant Mouse ENOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENOX1-844H | Recombinant Human ENOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENOX1-1426H | Recombinant Human ENOX1 Protein, His-tagged | +Inquiry |
Enox1-2829M | Recombinant Mouse Enox1 Protein, Myc/DDK-tagged | +Inquiry |
ENOX1-185H | Recombinant Human ENOX1 protein, GST-tagged | +Inquiry |
◆ Lysates | ||
ENOX1-6596HCL | Recombinant Human ENOX1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All ENOX1 Products
Required fields are marked with *
My Review for All ENOX1 Products
Required fields are marked with *
0
Inquiry Basket