Recombinant Human EPB41L3, His-tagged
Cat.No. : | EPB41L3-28576TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 949-1087 of Human EPB41L3 with N terminal His tag; Predicted MWt 16 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Band 4.1-like protein 3 is a protein that in humans is encoded by the EPB41L3 gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 126 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | STVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYE SSQVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTV KGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQH PDMSVTKVVVHKETEITPEDGED |
Gene Name : | EPB41L3 erythrocyte membrane protein band 4.1-like 3 [ Homo sapiens ] |
Official Symbol : | EPB41L3 |
Synonyms : | EPB41L3; erythrocyte membrane protein band 4.1-like 3; band 4.1-like protein 3; 4.1B; DAL1; KIAA0987; |
Gene ID : | 23136 |
mRNA Refseq : | NM_012307 |
Protein Refseq : | NP_036439 |
MIM : | 605331 |
Uniprot ID : | Q9Y2J2 |
Chromosome Location : | 18p11.32 |
Pathway : | Tight junction, organism-specific biosystem; Tight junction, conserved biosystem; |
Function : | actin binding; protein binding; structural molecule activity; |
Products Types
◆ Recombinant Protein | ||
EPB41L3-3356H | Recombinant Human EPB41L3 Protein, GST-tagged | +Inquiry |
EPB41L3-30139H | Recombinant Human EPB41L3 protein, GST-tagged | +Inquiry |
EPB41L3-12479H | Recombinant Human EPB41L3, GST-tagged | +Inquiry |
◆ Lysates | ||
EPB41L3-562HCL | Recombinant Human EPB41L3 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket