Recombinant Human EZH2, His-tagged

• Cat.No.: EZH2-29233TH
• Product Overview: Recombinant fragment, corresponding to amino acids 558-707 of Human KMT6/EZH2 isoform 3 with an N-terminal His Tag, 150 amino aicds, approximately 24kDa.

Specification

• Description: This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Expressed in many tissues. Overexpressed in numerous tumor types including carcinomas of the breast, colon, larynx, lymphoma and testis.
• Form: Lyophilised:reconstitution with 60 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNE FISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFV VDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFA KRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
• Sequence Similarities: Belongs to the histone-lysine methyltransferase family. EZ subfamily.Contains 1 SET domain.

Gene Information

• Gene Name: EZH2 enhancer of zeste homolog 2 (Drosophila) [ Homo sapiens ]
• Official Symbol: EZH2
• Synonyms: EZH2; enhancer of zeste homolog 2 (Drosophila); enhancer of zeste (Drosophila) homolog 2; histone-lysine N-methyltransferase EZH2; ENX 1; EZH1; KMT6; KMT6A
• Gene ID: 2146
• mRNA Refseq: NM_001203247
• Protein Refseq: NP_001190176
• MIM: 601573
• Uniprot ID: Q15910
• Chromosome Location: 7q35-q36
• Function: DNA binding; histone methyltransferase activity; histone-lysine N-methyltransferase activity; methyltransferase activity; protein binding