Recombinant Human GLRA2

• Cat.No.: GLRA2-27147TH
• Product Overview: Recombinant fragment corresponding to amino acis 151-252 of Human alpha 2 Glycine Receptor with a N terminal proprietary tag; predicted MWt 36.85 kDa inclusive of tag.

Specification

• Description: The glycine receptor consists of two subunits, alpha and beta, and acts as a pentamer. The protein encoded by this gene is an alpha subunit and can bind strychnine. Several transcript variants encoding different isoforms have been found for this gene.
• Protein length: 102 amino acids
• Molecular Weight: 36.850kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQL ESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELG YCTKHYNTGKFTCIEVKFHLER
• Sequence Similarities: Belongs to the ligand-gated ion channel (TC 1.A.9) family. Glycine receptor (TC 1.A.9.3) subfamily. GLRA2 sub-subfamily.

Gene Information

• Gene Name: GLRA2 glycine receptor, alpha 2 [ Homo sapiens ]
• Official Symbol: GLRA2
• Synonyms: GLRA2; glycine receptor, alpha 2; GLR; glycine receptor subunit alpha-2
• Gene ID: 2742
• mRNA Refseq: NM_001118885
• Protein Refseq: NP_001112357
• MIM: 305990
• Uniprot ID: P23416
• Chromosome Location: Xp22.1-p21.3
• Pathway: Ion channel transport, organism-specific biosystem; Ligand-gated ion channel transport, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; Transmembrane transport of small molecules, organism-specific biosystem
• Function: extracellular ligand-gated ion channel activity; extracellular-glycine-gated chloride channel activity; glycine binding; ion channel activity; receptor activity