Recombinant Human GSN
Cat.No. : | GSN-29012TH |
Product Overview : | Recombinant fragment corresponding to amino acids 673-782 of Human Gelsolin with an N terminal proprietary tag; Predicted MWt 37.84 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.840kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Phagocytic cells, platelets, fibroblasts, nonmuscle cells, smooth and skeletal muscle cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVG KDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFE PPSFVGWFLGWDDDYWSVDPLDRAMAELAA |
Sequence Similarities : | Belongs to the villin/gelsolin family.Contains 6 gelsolin-like repeats. |
Gene Name : | GSN gelsolin [ Homo sapiens ] |
Official Symbol : | GSN |
Synonyms : | GSN; gelsolin; gelsolin (amyloidosis, Finnish type); amyloidosis; Finnish type; DKFZp313L0718; |
Gene ID : | 2934 |
mRNA Refseq : | NM_000177 |
Protein Refseq : | NP_000168 |
MIM : | 137350 |
Uniprot ID : | P06396 |
Chromosome Location : | 9q33 |
Pathway : | Amyloids, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Caspase cascade in apoptosis, organism-specific biosystem; |
Function : | actin binding; calcium ion binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
GSN-2221H | Recombinant Human GSN Protein, His-tagged | +Inquiry |
GSN-13H | Active Recombinant Human GSN Protein (125-150aa), N-6×His-tagged | +Inquiry |
GSN-2220H | Recombinant Human GSN Protein, His-tagged | +Inquiry |
GSN-1028H | Recombinant Human GSN Protein, His (Fc)-Avi-tagged | +Inquiry |
Gsn-3320M | Recombinant Mouse Gsn Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Protein | ||
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
GSN-876P | Active Native Porcine GSN Protein | +Inquiry |
GSN-875B | Active Native Bovine GSN Protein | +Inquiry |
◆ Lysates | ||
GSN-5722HCL | Recombinant Human GSN 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket