Recombinant Human HPGDS
Cat.No. : | HPGDS-30587TH |
Product Overview : | Recombinant full length Human Prostaglandin D Synthase produced in Saccharomyces cerevisiae; amino acids 1-199 , 23.3kDa. |
- Specification
- Gene Information
- Related Products
Description : | Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. |
Form : | Liquid |
Purity : | Immunogen affinity purified |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWP EIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLA GNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMF NELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEIC STTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRR PQTKL |
Gene Name : | HPGDS hematopoietic prostaglandin D synthase [ Homo sapiens ] |
Official Symbol : | HPGDS |
Synonyms : | HPGDS; hematopoietic prostaglandin D synthase; glutathione S transferase sigma; GSTS; H PGDS; PGDS; |
Gene ID : | 27306 |
mRNA Refseq : | NM_014485 |
Protein Refseq : | NP_055300 |
MIM : | 602598 |
Uniprot ID : | O60760 |
Chromosome Location : | 4q22.2 |
Pathway : | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function : | calcium ion binding; glutathione transferase activity; isomerase activity; magnesium ion binding; prostaglandin-D synthase activity; |
Products Types
◆ Recombinant Protein | ||
HPGDS-1959R | Recombinant Rhesus Macaque HPGDS Protein, His (Fc)-Avi-tagged | +Inquiry |
HPGDS-4307M | Recombinant Mouse HPGDS Protein, His (Fc)-Avi-tagged | +Inquiry |
HPGDS-0142H | Recombinant Human HPGDS Protein (M1-L199), His/Strep tagged | +Inquiry |
HPGDS-2558R | Recombinant Rat HPGDS Protein, His (Fc)-Avi-tagged | +Inquiry |
HPGDS-55H | Recombinant Human HPGDS Protein, His-tagged | +Inquiry |
◆ Lysates | ||
HPGDS-5401HCL | Recombinant Human HPGDS 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket