Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human HSPB7, His-tagged

Cat.No. : HSPB7-26656TH
Product Overview : Recombinant full length Human cvHSP with an N-terminal His tag; predicted MWt 20.7 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
Description : HSPB7 is a member of HSPB (Heat shock protein beta) family. The HSPB family is one of the more diverse families within the group of HSP families. Some members have chaperone-like activities and/or play a role in cytoskeletal stabilization.
Protein length : 170 amino acids
Conjugation : HIS
Molecular Weight : 20.700kDa inclusive of tags
Source : E. coli
Tissue specificity : Isoform 1 is highly expressed in adult and fetal heart, skeletal muscle, and at a much lower levels in adipose tissue and in aorta. Undetectable in other tissues. Isoform 2 and isoform 3 are poorly detected in heart.
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 1.17% Sodium chloride, 0.03% DTT, 50% Glycerol
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSHRTSSTFRAERSFHSSSS SSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHS EPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTT SNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSA LREDGSLTIRARRHPHTEHVQQTFRTEIKI
Sequence Similarities : Belongs to the small heat shock protein (HSP20) family.
Gene Name : HSPB7 heat shock 27kDa protein family, member 7 (cardiovascular) [ Homo sapiens ]
Official Symbol : HSPB7
Synonyms : HSPB7; heat shock 27kDa protein family, member 7 (cardiovascular); heat shock 27kD protein family, member 7 (cardiovascular); heat shock protein beta-7; cvHSP;
Gene ID : 27129
mRNA Refseq : NM_014424
Protein Refseq : NP_055239
MIM : 610692
Uniprot ID : Q9UBY9
Chromosome Location : 1p36.23-p34.3
Function : protein C-terminus binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends