Recombinant Human MRPS23, His-tagged
Cat.No. : | MRPS23-28174TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-190 of Human MRPS23 with N terminal His tag; MWt 30kDa. |
- Specification
- Gene Information
- Related Products
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 7p. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 89 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAGSRLETVGSIFSRTRDLVRAGVLKEKPLWFDVYDAFPP LREPVFQRPRVRYGKAKAPIQDIWYHEDRIRAKFYSVY GSGQRAFDLFNPNFKSTCQRFVEKYTELQKLGETDEEK LFVETGKALLAEGVILRRVGEARTQHGGSHVSRKSEHL SVRPQTALEENETQKEVPQDQHLEAPADQSKGLLPP |
Gene Name : | MRPS23 mitochondrial ribosomal protein S23 [ Homo sapiens ] |
Official Symbol : | MRPS23 |
Synonyms : | MRPS23; mitochondrial ribosomal protein S23; 28S ribosomal protein S23, mitochondrial; CGI 138; HSPC329; MRP S23; |
Gene ID : | 51649 |
mRNA Refseq : | NM_016070 |
Protein Refseq : | NP_057154 |
MIM : | 611985 |
Uniprot ID : | Q9Y3D9 |
Chromosome Location : | 17q22-q23 |
Function : | structural constituent of ribosome; |
Products Types
◆ Recombinant Protein | ||
MRPS23-1943H | Recombinant Human MRPS23 Protein, DDK-tagged | +Inquiry |
MRPS23-5612H | Recombinant Human MRPS23 Protein, GST-tagged | +Inquiry |
MRPS23-2681R | Recombinant Rhesus Macaque MRPS23 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS23-2861R | Recombinant Rhesus monkey MRPS23 Protein, His-tagged | +Inquiry |
MRPS23-1041Z | Recombinant Zebrafish MRPS23 | +Inquiry |
◆ Lysates | ||
MRPS23-4143HCL | Recombinant Human MRPS23 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket