Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human NOTCH3

Cat.No. : NOTCH3-29729TH
Product Overview : Recombinant fragment of Human NOTCH3 with N terminal proprietary tag, 37.73kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL).
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Ubiquitously expressed in fetal and adult tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGP CAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCL SSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR
Sequence Similarities : Belongs to the NOTCH family.Contains 5 ANK repeats.Contains 34 EGF-like domains.Contains 3 LNR (Lin/Notch) repeats.
Gene Name : NOTCH3 notch 3 [ Homo sapiens ]
Official Symbol : NOTCH3
Synonyms : NOTCH3; notch 3; CADASIL, Notch (Drosophila) homolog 3 , Notch homolog 3 (Drosophila); neurogenic locus notch homolog protein 3; CASIL;
Gene ID : 4854
mRNA Refseq : NM_000435
Protein Refseq : NP_000426
MIM : 600276
Uniprot ID : Q9UM47
Chromosome Location : 19p13.2-p13.1
Pathway : A third proteolytic cleavage releases NICD, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Dorso-ventral axis formation, organism-specific biosystem; Dorso-ventral axis formation, conserved biosystem; Gene Expression, organism-specific biosystem;
Function : calcium ion binding; protein binding; receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends