Recombinant Human PARK2
Cat.No. : | PARK2-30784TH |
Product Overview : | Recombinant full length Human Parkin with N terminal proprietary tag; Predicted MWt 68.64 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support. |
Protein length : | 387 amino acids |
Molecular Weight : | 68.640kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons fro |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQ LRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQ EMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVG LAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQR VQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGEC QSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSR NITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLND RQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGC PNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCP RPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK |
Sequence Similarities : | Belongs to the RBR family. Parkin subfamily.Contains 1 IBR-type zinc finger.Contains 2 RING-type zinc fingers.Contains 1 ubiquitin-like domain. |
Gene Name : | PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) [ Homo sapiens ] |
Official Symbol : | PARK2 |
Synonyms : | PARK2; parkinson protein 2, E3 ubiquitin protein ligase (parkin); Parkinson disease (autosomal recessive, juvenile) 2, parkin; E3 ubiquitin-protein ligase parkin; AR JP; E3 ubiquitin ligase; parkin; PDJ; |
Gene ID : | 5071 |
mRNA Refseq : | NM_004562 |
Protein Refseq : | NP_004553 |
MIM : | 602544 |
Uniprot ID : | O60260 |
Chromosome Location : | 6q25.2-q27 |
Pathway : | Adaptive Immune System, organism-specific biosystem; Alpha-synuclein signaling, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & |
Function : | PDZ domain binding; acid-amino acid ligase activity; chaperone binding; kinase binding; ligase activity; |
Products Types
◆ Recombinant Protein | ||
PARK2-6497M | Recombinant Mouse PARK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PARK2-516C | Recombinant Cynomolgus Monkey PARK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PARK2-3935R | Recombinant Rat PARK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PARK2-30785TH | Recombinant Human PARK2 | +Inquiry |
PARK2-11H | Recombinant Human PARK2 protein, His-tagged | +Inquiry |
◆ Lysates | ||
PARK2-3433HCL | Recombinant Human PARK2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionBesides Parkinson's disease, PARK2 mutations have been linked to other neurodegenerative disorders, expanding the clinical implications of studying this protein.
Yes, drug development efforts are underway to modulate PARK2 activity and enhance its neuroprotective functions as a potential therapeutic approach for Parkinson's disease.
PARK2 research provides crucial insights into the role of mitochondrial dynamics in neurodegenerative diseases, helping unravel the mechanisms underlying these disorders and paving the way for targeted therapies.
Genetic testing can help identify individuals with PARK2 mutations, allowing for personalized treatment strategies tailored to their specific genetic profile.
PARK2 is implicated in controlling inflammation in the brain, and its dysfunction may contribute to neuroinflammatory processes observed in Parkinson's disease.
Customer Reviews (3)
Write a reviewTheir expertise and commitment to customer satisfaction make them a trusted partner in achieving research goals.
Their knowledgeable team is readily available to address any questions or concerns, guaranteeing a smooth experimental process.
the manufacturer of PARK2 protein provides excellent technical support, ensuring prompt assistance and guidance.
Ask a Question for All PARK2 Products
Required fields are marked with *
My Review for All PARK2 Products
Required fields are marked with *
Inquiry Basket