Recombinant Human PI4KA

• Cat.No.: PI4KA-30331TH
• Product Overview: Recombinant fragment of Human Phosphatidylinositol 4 kinase III alpha protein, Isoform 2 with N-terminal proprietary tag. Predicted MW 37.73kDa.

Specification

• Description: This gene encodes a phosphatidylinositol (PI) 4-kinase which catalyzes the first committed step in the biosynthesis of phosphatidylinositol 4,5-bisphosphate. The mammalian PI 4-kinases have been classified into two types, II and III, based on their molecular mass, and modulation by detergent and adenosine. The protein encoded by this gene is a type III enzyme that is not inhibited by adenosine. Two transcript variants encoding different isoforms have been described for this gene.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa
• Source: Wheat germ
• Tissue specificity: Expressed ubiquitously. Highest levels in placenta and brain. Little or no expression in lung, liver, pancreas, testis or leukocytes.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTGLSYFS SMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDK MGYVREYILWAASKSQLLAHQFIWNMKTNI
• Sequence Similarities: Belongs to the PI3/PI4-kinase family. Type III PI4K subfamily.Contains 1 PI3K/PI4K domain.

Gene Information

• Gene Name: PI4KA phosphatidylinositol 4-kinase, catalytic, alpha [ Homo sapiens ]
• Official Symbol: PI4KA
• Synonyms: PI4KA; phosphatidylinositol 4-kinase, catalytic, alpha; PIK4CA; phosphatidylinositol 4-kinase alpha; PI4K ALPHA; pi4K230
• Gene ID: 5297
• mRNA Refseq: NM_002650
• Protein Refseq: NP_002641
• MIM: 600286
• Uniprot ID: P42356
• Chromosome Location: 22q11.21
• Pathway: 3-phosphoinositide biosynthesis, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate biosynthesis, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Inositol phosphate metabolism, PI=>
• Function: 1-phosphatidylinositol 4-kinase activity; ATP binding; kinase activity; nucleotide binding; protein binding