Recombinant Human PPIF
Cat.No. : | PPIF-27049TH |
Product Overview : | Recombinant full length human Cyclophilin F; 198 amino acids, 21 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death. |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris, 1mM DTT, pH 7.5 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHCSKGSGDPSSSSSSGNPLVY LDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG YKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDEN FTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHV VFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS |
Gene Name : | PPIF peptidylprolyl isomerase F [ Homo sapiens ] |
Official Symbol : | PPIF |
Synonyms : | PPIF; peptidylprolyl isomerase F; peptidylprolyl isomerase F (cyclophilin F); peptidyl-prolyl cis-trans isomerase F, mitochondrial; cyclophilin D; Cyp D; hCyP3; |
Gene ID : | 10105 |
mRNA Refseq : | NM_005729 |
Protein Refseq : | NP_005720 |
MIM : | 604486 |
Uniprot ID : | P30405 |
Chromosome Location : | 10q22-q23 |
Pathway : | Toxoplasmosis, organism-specific biosystem; Toxoplasmosis, conserved biosystem; |
Function : | cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; |
Products Types
◆ Recombinant Protein | ||
Ppif-284M | Recombinant Mouse Ppif Protein, MYC/DDK-tagged | +Inquiry |
PPIF-0851H | Recombinant Human PPIF Protein (S43-S207), His tagged | +Inquiry |
PPIF-0852H | Recombinant Human PPIF Protein (S43-S207), Tag Free | +Inquiry |
PPIF-4262R | Recombinant Rat PPIF Protein, His (Fc)-Avi-tagged | +Inquiry |
PPIF-631H | Recombinant Human PPIF protein(Cys30-Ser207), His-tagged | +Inquiry |
◆ Lysates | ||
PPIF-2970HCL | Recombinant Human PPIF 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All PPIF Products
Required fields are marked with *
My Review for All PPIF Products
Required fields are marked with *
0
Inquiry Basket