Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PRMT2, His-tagged

Cat.No. : PRMT2-31115TH
Product Overview : Recombinant fragment, corresponding to amino acids 286-433 of Human PRMT2 with an N terminal His tag. Predicted MWt: 18 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Protein arginine N-methyltransferase 2 is an enzyme that in humans is encoded by the PRMT2 gene.
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitous.
Form : Lyophilised:Reconstitute with 102 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGE LRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGP FHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVW RRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR
Sequence Similarities : Belongs to the protein arginine N-methyltransferase family.Contains 1 SH3 domain.
Gene Name : PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ]
Official Symbol : PRMT2
Synonyms : PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373;
Gene ID : 3275
mRNA Refseq : NM_001242864
Protein Refseq : NP_001229793
MIM : 601961
Uniprot ID : P55345
Chromosome Location : 21q22.3
Pathway : mRNA processing, organism-specific biosystem;
Function : androgen receptor binding; estrogen receptor binding; estrogen receptor binding; histone methyltransferase activity; histone-arginine N-methyltransferase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All PRMT2 Products

Required fields are marked with *

My Review for All PRMT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends