Recombinant Human SDHB, His-tagged
Cat.No. : | SDHB-31392TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-280 of Human SDHB with N terminal His tag, MWt 35kDa. |
- Specification
- Gene Information
- Related Products
Description : | Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 96 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIK KFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIK IKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRR IDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIE PYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCST SCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLA KLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMM ATYKEKKASV |
Sequence Similarities : | Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.Contains 1 2Fe-2S ferredoxin-type domain.Contains 1 4Fe-4S ferredoxin-type domain. |
Gene Name : | SDHB succinate dehydrogenase complex, subunit B, iron sulfur (Ip) [ Homo sapiens ] |
Official Symbol : | SDHB |
Synonyms : | SDHB; succinate dehydrogenase complex, subunit B, iron sulfur (Ip); SDH, SDH1; succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; |
Gene ID : | 6390 |
mRNA Refseq : | NM_003000 |
Protein Refseq : | NP_002991 |
MIM : | 185470 |
Uniprot ID : | P21912 |
Chromosome Location : | 1p36.1-p35 |
Pathway : | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate => |
Function : | 2 iron, 2 sulfur cluster binding; 3 iron, 4 sulfur cluster binding; 4 iron, 4 sulfur cluster binding; electron carrier activity; metal ion binding; |
Products Types
◆ Recombinant Protein | ||
SDHB-3929R | Recombinant Rhesus Macaque SDHB Protein, His (Fc)-Avi-tagged | +Inquiry |
SDHB-4039H | Recombinant Human SDHB Protein, His (Fc)-Avi-tagged | +Inquiry |
SDHB-2677H | Recombinant Human SDHB Protein, His-tagged | +Inquiry |
SDHB-4951R | Recombinant Rat SDHB Protein, His (Fc)-Avi-tagged | +Inquiry |
SDHB-5703Z | Recombinant Zebrafish SDHB | +Inquiry |
◆ Lysates | ||
SDHB-2009HCL | Recombinant Human SDHB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket