Recombinant Human SIGIRR, His-tagged
Cat.No. : | SIGIRR-28785TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 203-410 of Human SIGIRR with N terminal His tag; 208 amino acids, 32kDa. |
- Specification
- Gene Information
- Related Products
Description : | Single Ig IL-1-related receptor is a protein that in humans is encoded by the SIGIRR gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Mainly expressed in epithelial tissues such as kidney, lung and gut. |
Form : | Lyophilised:Reconstitute with 121 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSHSF REGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHR HLVTLLLWRPGSVTPSSDFWKEVQLALPRKVQYRPVEGDP QTQLQDDKDPMLILRGRVPEGRALDSEVDPDPEGDLGV RGPVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYS ARTDFYCLVSKDDM |
Sequence Similarities : | Belongs to the interleukin-1 receptor family.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 TIR domain. |
Gene Name : | SIGIRR single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Homo sapiens ] |
Official Symbol : | SIGIRR |
Synonyms : | SIGIRR; single immunoglobulin and toll-interleukin 1 receptor (TIR) domain; single Ig IL-1-related receptor; single immunoglobulin domain IL1R1 related; TIR8; |
Gene ID : | 59307 |
mRNA Refseq : | NM_001135053 |
Protein Refseq : | NP_001128525 |
MIM : | 605478 |
Uniprot ID : | Q6IA17 |
Chromosome Location : | 11p15.5 |
Pathway : | Activated TLR4 signalling, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88:Mal cascade initiated on plasma membrane, organism-specific biosystem; Toll Like Receptor 2 (TLR2) Cascade, organism-specific biosystem; |
Function : | protein binding; transmembrane signaling receptor activity; |
Products Types
◆ Recombinant Protein | ||
SIGIRR-2054M | Recombinant Mouse SIGIRR Protein (1-117 aa), His-tagged | +Inquiry |
Sigirr-5875M | Recombinant Mouse Sigirr Protein, Myc/DDK-tagged | +Inquiry |
SIGIRR-4483H | Recombinant Human SIGIRR Protein, His (Fc)-Avi-tagged | +Inquiry |
SIGIRR-5059R | Recombinant Rat SIGIRR Protein, His (Fc)-Avi-tagged | +Inquiry |
Sigirr-10614M | Recombinant Mouse Sigirr Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
SIGIRR-1091HCL | Recombinant Human SIGIRR cell lysate | +Inquiry |
SIGIRR-2773MCL | Recombinant Mouse SIGIRR cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket