Recombinant Human SP1, His-tagged

• Cat.No.: SP1-30987TH
• Product Overview: Recombinant fragment, corresponding to amino acids 645-778 of Human SP1 with N terminal His tag; 134 amino acids, 17kDa.

Specification

• Description: The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Up-regulated in adenocarcinomas of the stomach (at protein level).
• Form: Lyophilised:Reconstitute with 148 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Store at 4°C. Upon reconstitution store at -80oC.
• Sequences of amino acids: GERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPEC PKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSG AGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINV MQVADLQSINISGNGF
• Sequence Similarities: Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.

Gene Information

• Gene Name: SP1 Sp1 transcription factor [ Homo sapiens ]
• Official Symbol: SP1
• Synonyms: SP1; Sp1 transcription factor; transcription factor Sp1; specificity protein 1
• Gene ID: 6667
• mRNA Refseq: NM_001251825
• Protein Refseq: NP_001238754
• MIM: 189906
• Uniprot ID: P08047
• Chromosome Location: 12q13.1
• Pathway: Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem
• Function: DNA binding; HMG box domain binding; double-stranded DNA binding; enhancer binding; histone acetyltransferase binding

Reviews

11/25/2020

In addition to their expertise, the manufacturer's technical support team can assist in troubleshooting and optimizing the handling and application of the SP1 protein.

02/25/2019

Its reliable and accurate performance ensures dependable results, contributing to the advancement of scientific knowledge in various disciplines.

09/25/2017

By relying on the SP1 protein and the manufacturer's exceptional technical support, researchers can confidently pursue their experimental goals while knowing they have access to reliable resources and expert guidance.

Q&As

How does SP1 affect immune response?

SP1 plays a role in immune response by regulating the expression of genes involved in inflammation and immune cell function. Its modulation can influence the immune system's response to various stimuli.

Does SP1 have a role in cardiovascular diseases?

Yes, SP1 is implicated in cardiovascular diseases by regulating genes involved in vascular smooth muscle cell proliferation and migration. Targeting SP1 may offer therapeutic avenues for cardiovascular conditions.

Is SP1 involved in neurodegenerative diseases?

Yes, SP1 has been implicated in neurodegenerative diseases. Its role in regulating genes related to neuronal survival and death makes it a target for exploring therapeutic interventions in conditions like Alzheimer's disease.

Can SP1 protein be used as a diagnostic marker for cancer?

Yes, elevated levels of SP1 have been observed in certain cancers. Detection of SP1 expression can potentially serve as a diagnostic marker, aiding in the early identification of cancer.

How does SP1 contribute to angiogenesis?

SP1 regulates the expression of genes involved in angiogenesis, the formation of new blood vessels. Increased SP1 activity is associated with enhanced angiogenesis, which can be critical in wound healing and tumor growth.