Recombinant Human SP1, His-tagged
Cat.No. : | SP1-30987TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 645-778 of Human SP1 with N terminal His tag; 134 amino acids, 17kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Up-regulated in adenocarcinomas of the stomach (at protein level). |
Form : | Lyophilised:Reconstitute with 148 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | GERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPEC PKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSG AGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINV MQVADLQSINISGNGF |
Sequence Similarities : | Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers. |
Gene Name : | SP1 Sp1 transcription factor [ Homo sapiens ] |
Official Symbol : | SP1 |
Synonyms : | SP1; Sp1 transcription factor; transcription factor Sp1; specificity protein 1; |
Gene ID : | 6667 |
mRNA Refseq : | NM_001251825 |
Protein Refseq : | NP_001238754 |
MIM : | 189906 |
Uniprot ID : | P08047 |
Chromosome Location : | 12q13.1 |
Pathway : | Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; |
Function : | DNA binding; HMG box domain binding; double-stranded DNA binding; enhancer binding; histone acetyltransferase binding; |
Products Types
◆ Recombinant Protein | ||
SP1-4233R | Recombinant Rhesus Macaque SP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SP1-5336R | Recombinant Rat SP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SP1-2587H | Recombinant Human SP1 protein(581-660 aa), C-His-tagged | +Inquiry |
SP1-1956H | Recombinant Human SP1 protein, His & GST-tagged | +Inquiry |
SP1-16H | Recombinant Human SP1 protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionSP1 plays a role in immune response by regulating the expression of genes involved in inflammation and immune cell function. Its modulation can influence the immune system's response to various stimuli.
Yes, SP1 is implicated in cardiovascular diseases by regulating genes involved in vascular smooth muscle cell proliferation and migration. Targeting SP1 may offer therapeutic avenues for cardiovascular conditions.
Yes, SP1 has been implicated in neurodegenerative diseases. Its role in regulating genes related to neuronal survival and death makes it a target for exploring therapeutic interventions in conditions like Alzheimer's disease.
Yes, elevated levels of SP1 have been observed in certain cancers. Detection of SP1 expression can potentially serve as a diagnostic marker, aiding in the early identification of cancer.
SP1 regulates the expression of genes involved in angiogenesis, the formation of new blood vessels. Increased SP1 activity is associated with enhanced angiogenesis, which can be critical in wound healing and tumor growth.
Customer Reviews (3)
Write a reviewIn addition to their expertise, the manufacturer's technical support team can assist in troubleshooting and optimizing the handling and application of the SP1 protein.
Its reliable and accurate performance ensures dependable results, contributing to the advancement of scientific knowledge in various disciplines.
By relying on the SP1 protein and the manufacturer's exceptional technical support, researchers can confidently pursue their experimental goals while knowing they have access to reliable resources and expert guidance.
Ask a Question for All SP1 Products
Required fields are marked with *
My Review for All SP1 Products
Required fields are marked with *
Inquiry Basket