Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SRD5A2

Cat.No. : SRD5A2-31394TH
Product Overview : Recombinant fragment of Human SRD5A2 with an N terminal proprietary tag; Predicted MW 29.81kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).
Protein length : 38 amino acids
Molecular Weight : 29.810kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in high levels in the prostate and many other androgen-sensitive tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA
Sequence Similarities : Belongs to the steroid 5-alpha reductase family.
Gene Name : SRD5A2 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) [ Homo sapiens ]
Official Symbol : SRD5A2
Synonyms : SRD5A2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); 3-oxo-5-alpha-steroid 4-dehydrogenase 2;
Gene ID : 6716
mRNA Refseq : NM_000348
Protein Refseq : NP_000339
Uniprot ID : P31213
Chromosome Location : 2p23.1
Pathway : Androgen biosynthesis, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem;
Function : 3-oxo-5-alpha-steroid 4-dehydrogenase activity; sterol 5-alpha reductase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends