Recombinant Human VTA1
Cat.No. : | VTA1-31541TH |
Product Overview : | Recombinant full length Human VTA1 expressed in Saccharomyces cerevisiae, 307 amino acids , |
- Specification
- Gene Information
- Related Products
- Download
Description : | C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRL YAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNE AITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIK SFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCL KNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPS SSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEVPHST GVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARA QKYCKYAGSALQYEDVSTAVQNLQKALKLLTTGRE |
Sequence Similarities : | Belongs to the VTA1 family. |
Gene Name : | VTA1 Vps20-associated 1 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol : | VTA1 |
Synonyms : | VTA1; Vps20-associated 1 homolog (S. cerevisiae); C6orf55, chromosome 6 open reading frame 55; vacuolar protein sorting-associated protein VTA1 homolog; HSPC228; My012; |
Gene ID : | 51534 |
mRNA Refseq : | NM_016485 |
Protein Refseq : | NP_057569 |
MIM : | 610902 |
Uniprot ID : | Q9NP79 |
Chromosome Location : | 6q24.1 |
Pathway : | Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
Products Types
◆ Recombinant Protein | ||
VTA1-2349H | Recombinant Human VTA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VTA1-10090M | Recombinant Mouse VTA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VTA1-4993R | Recombinant Rhesus Macaque VTA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Vta1-6954M | Recombinant Mouse Vta1 Protein, Myc/DDK-tagged | +Inquiry |
VTA1-5554H | Recombinant Human Vps20-Associated 1 Homolog (S. cerevisiae), His-tagged | +Inquiry |
◆ Lysates | ||
VTA1-375HCL | Recombinant Human VTA1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All VTA1 Products
Required fields are marked with *
My Review for All VTA1 Products
Required fields are marked with *
0
Inquiry Basket