Recombinant Human XRCC4, His-tagged
Cat.No. : | XRCC4-30134TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-334 of Human XRCC4 with N terminal His tag, Predicted MWt 39 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. The non-homologous end-joining pathway is required both for normal development and for suppression of tumors. This gene functionally complements XR-1 Chinese hamster ovary cell mutant, which is impaired in DNA double-strand breaks produced by ionizing radiation and restriction enzymes. Alternative transcription initiation and alternative splicing generates several transcript variants. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Widely expressed. |
Form : | Lyophilised:Reconstitute with 91 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGH SAWTGTVSESEISQEADDMAMEKGKYVGELRKALLSGA GPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKV ENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRD WNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSL HNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDES TDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSR KRRQRMQRNLGTEPKMAPQENQLQEKEKPDSSLPETSK KEHISAENMSLETLRNSSPEDLFDEI |
Sequence Similarities : | Belongs to the XRCC4 family. |
Gene Name : | XRCC4 X-ray repair complementing defective repair in Chinese hamster cells 4 [ Homo sapiens ] |
Official Symbol : | XRCC4 |
Synonyms : | XRCC4; X-ray repair complementing defective repair in Chinese hamster cells 4; DNA repair protein XRCC4; X ray repair; complementing defective; repair in Chinese hamster; |
Gene ID : | 7518 |
mRNA Refseq : | NM_022550 |
Protein Refseq : | NP_072044 |
MIM : | 194363 |
Uniprot ID : | Q13426 |
Chromosome Location : | 5q14.2 |
Pathway : | 2-LTR circle formation, organism-specific biosystem; DNA Repair, organism-specific biosystem; Double-Strand Break Repair, organism-specific biosystem; Early Phase of HIV Life Cycle, organism-specific biosystem; HIV Infection, organism-specific biosystem; |
Function : | NOT DNA binding; NOT ligase activity; protein C-terminus binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
Xrcc4-364M | Recombinant Mouse Xrcc4 Protein, MYC/DDK-tagged | +Inquiry |
XRCC4-2370H | Recombinant Human XRCC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
XRCC4-10242M | Recombinant Mouse XRCC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
XRCC4-078H | Recombinant Human XRCC4 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
XRCC4-833C | Recombinant Cynomolgus Monkey XRCC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
XRCC4-255HCL | Recombinant Human XRCC4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionResistance mechanisms and potential side effects of XRCC4-targeted therapies pose challenges in cancer treatment.
Understanding XRCC4 function may lead to the development of targeted therapies to enhance cancer treatment efficacy.
XRCC4 is a potential target for the development of novel cancer therapies aimed at disrupting DNA repair mechanisms.
XRCC4 levels or mutations may have potential as biomarkers for certain cancers and their response to treatment.
Certain genetic variations in XRCC4 have been associated with an increased risk of developing certain types of cancer.
Customer Reviews (3)
Write a reviewTheir team of experts is readily available to address any issues that may arise, providing solutions to problems and guiding me through the experimental process.
Its seamless integration makes it possible to explore different research avenues, expanding the scope and impact of my investigations.
With the manufacturer's excellent technical support and its wide range of applications, the XRCC4 protein has become an indispensable tool, aiding in my research endeavors and driving meaningful scientific discoveries.
Ask a Question for All XRCC4 Products
Required fields are marked with *
My Review for All XRCC4 Products
Required fields are marked with *
Inquiry Basket