Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human XRCC4, His-tagged

Cat.No. : XRCC4-30134TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-334 of Human XRCC4 with N terminal His tag, Predicted MWt 39 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. The non-homologous end-joining pathway is required both for normal development and for suppression of tumors. This gene functionally complements XR-1 Chinese hamster ovary cell mutant, which is impaired in DNA double-strand breaks produced by ionizing radiation and restriction enzymes. Alternative transcription initiation and alternative splicing generates several transcript variants.
Conjugation : HIS
Source : E. coli
Tissue specificity : Widely expressed.
Form : Lyophilised:Reconstitute with 91 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGH SAWTGTVSESEISQEADDMAMEKGKYVGELRKALLSGA GPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKV ENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRD WNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSL HNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDES TDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSR KRRQRMQRNLGTEPKMAPQENQLQEKEKPDSSLPETSK KEHISAENMSLETLRNSSPEDLFDEI
Sequence Similarities : Belongs to the XRCC4 family.
Gene Name : XRCC4 X-ray repair complementing defective repair in Chinese hamster cells 4 [ Homo sapiens ]
Official Symbol : XRCC4
Synonyms : XRCC4; X-ray repair complementing defective repair in Chinese hamster cells 4; DNA repair protein XRCC4; X ray repair; complementing defective; repair in Chinese hamster;
Gene ID : 7518
mRNA Refseq : NM_022550
Protein Refseq : NP_072044
MIM : 194363
Uniprot ID : Q13426
Chromosome Location : 5q14.2
Pathway : 2-LTR circle formation, organism-specific biosystem; DNA Repair, organism-specific biosystem; Double-Strand Break Repair, organism-specific biosystem; Early Phase of HIV Life Cycle, organism-specific biosystem; HIV Infection, organism-specific biosystem;
Function : NOT DNA binding; NOT ligase activity; protein C-terminus binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
What are the challenges in targeting XRCC4 for cancer therapy? 11/12/2022

Resistance mechanisms and potential side effects of XRCC4-targeted therapies pose challenges in cancer treatment.

How can XRCC4 protein be targeted in cancer therapy? 09/22/2021

Understanding XRCC4 function may lead to the development of targeted therapies to enhance cancer treatment efficacy.

Can XRCC4 protein be a target for drug development? 06/20/2021

XRCC4 is a potential target for the development of novel cancer therapies aimed at disrupting DNA repair mechanisms.

Are there diagnostic applications of XRCC4 protein? 07/07/2017

XRCC4 levels or mutations may have potential as biomarkers for certain cancers and their response to treatment.

Are there genetic variations in XRCC4 that impact cancer risk? 03/26/2016

Certain genetic variations in XRCC4 have been associated with an increased risk of developing certain types of cancer.

Customer Reviews (3)

Write a review
Reviews
11/20/2022

    Their team of experts is readily available to address any issues that may arise, providing solutions to problems and guiding me through the experimental process.

    08/27/2022

      Its seamless integration makes it possible to explore different research avenues, expanding the scope and impact of my investigations.

      08/21/2019

        With the manufacturer's excellent technical support and its wide range of applications, the XRCC4 protein has become an indispensable tool, aiding in my research endeavors and driving meaningful scientific discoveries.

        Ask a Question for All XRCC4 Products

        Required fields are marked with *

        My Review for All XRCC4 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends