Recombinant Human ZFYVE21, His-tagged
Cat.No. : | ZFYVE21-31655TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 134-234 of Human ZFYVE21 with N terminal His tag; 101 amino acids, 23kDa. |
- Specification
- Gene Information
- Related Products
Description : | ZFYVE21 contains one FYVE-type zinc finger. Its function is unknown. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 99 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ETMTCRLSNNQRYLFLDGDSHYEIEIVHISTVQILTEGFP PGGGNARATGMFLQYTVPGTEGVTQLKLTVVEDVTVGR RQAVAWLVAMHKAAKLLYESRDQ |
Gene Name : | ZFYVE21 zinc finger, FYVE domain containing 21 [ Homo sapiens ] |
Official Symbol : | ZFYVE21 |
Synonyms : | ZFYVE21; zinc finger, FYVE domain containing 21; zinc finger FYVE domain-containing protein 21; MGC2550; ZF21; |
Gene ID : | 79038 |
mRNA Refseq : | NM_024071 |
Protein Refseq : | NP_076976 |
MIM : | 613504 |
Uniprot ID : | Q9BQ24 |
Chromosome Location : | 14q32.33 |
Function : | metal ion binding; |
Products Types
◆ Recombinant Protein | ||
ZFYVE21-10371M | Recombinant Mouse ZFYVE21 Protein, His (Fc)-Avi-tagged | +Inquiry |
Zfyve21-7103M | Recombinant Mouse Zfyve21 Protein, Myc/DDK-tagged | +Inquiry |
ZFYVE21-2387H | Recombinant Human ZFYVE21 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZFYVE21-7476Z | Recombinant Zebrafish ZFYVE21 | +Inquiry |
ZFYVE21-4912C | Recombinant Chicken ZFYVE21 | +Inquiry |
◆ Lysates | ||
ZFYVE21-174HCL | Recombinant Human ZFYVE21 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket