Recombinant Human ZNF638, His-tagged
Cat.No. : | ZNF638-31744TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1736-1978 of Human ZNF638 with N terminal His tag; Predicted MWt 28 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a nucleoplasmic protein. It binds cytidine-rich sequences in double-stranded DNA. This protein has three types of domains: MH1, MH2 (repeated three times) and MH3. It is associated with packaging, transferring, or processing transcripts. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 61 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VDEIQDDSSDLHLVTLDEVTEEDEDSLADFNNLKEELNFV TVDEVGEEEDGDNDLKVELAQSKNDHPTDKKGNRKKRA VDTKKTKLESLSQVGPVNENVMEEDLKTMIERHLTAKT PTKRVRIGKTLPSEKAVVTEPAKGEEAFQMSEVDEESG LKDSEPERKRKKTEDSSSGKSVASDVPEELDFLVPKAGFF CPICSLFYSGEKAMTNHCKSTRHKQNTEKFMAKQRKEK EQNEAEERSSR |
Gene Name : | ZNF638 zinc finger protein 638 [ Homo sapiens ] |
Official Symbol : | ZNF638 |
Synonyms : | ZNF638; zinc finger protein 638; ZFML, zinc finger, matrin like; MGC26130; NP220; Zfp638; |
Gene ID : | 27332 |
mRNA Refseq : | NM_014497 |
Protein Refseq : | NP_055312 |
Uniprot ID : | Q14966 |
Chromosome Location : | 2p13.1 |
Function : | DNA binding; RNA binding; double-stranded DNA binding; metal ion binding; nucleotide binding; |
Products Types
◆ Recombinant Protein | ||
ZNF638-3783H | Recombinant Human ZNF638 protein, His-SUMO-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All ZNF638 Products
Required fields are marked with *
My Review for All ZNF638 Products
Required fields are marked with *
0
Inquiry Basket