"DUT" Related Products

Expand

Recombinant Canis lupus DUT protein, His-tagged

Cat.No.: DUT-12C
Product Overview: Recombinant Canis lupus DUT fused with His tag was expressed in E. coli.
Source: E. coli
Species: Canis lupus
Tag : His
Form: 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0
Molecular Mass: ~18.136 kDa
AA Sequence: MGHHHHHHTPAISPSKRARPAEDGMRLRFVRLSEHATAPTKGSPRAAGYDLYSAYDYILPPMEKAIVKTDIQVALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGFGSTGKN
Endotoxin: < 1.0 EU per μg of the protein as determined by the LAL method
Purity: >95% by SDS-PAGE
Gene Name: DUT deoxyuridine triphosphatase [ Canis lupus familiaris ]
Official Symbol: DUT
Synonyms: deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial; dUTP pyrophosphatase
Gene ID: 609526
Chromosome Location: chromosome: 30
Pathway: Metabolic pathways, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.