Recombinant COVID-19 E & M Protein((1-16)+(2-19)+(72-79)), His-SUMO-tagged
Cat.No. : | E & M-0912V |
Product Overview : | Recombinant COVID-19 E & M Protein(P0DTC4(1-16)+P0DTC5(2-19)+P0DTC5(72-79)), fused with N-terminal His and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | COVID-19 |
Tag : | N-His-SUMO |
Protein length : | (1-16)+(2-19)+(72-79) |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.6 kDa |
AA Sequence : | MYSFVSEETGTLIVNSADSNGTITVEELKKLLEQRINWITGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All E & M Products
Required fields are marked with *
My Review for All E & M Products
Required fields are marked with *
0
Inquiry Basket