Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant E.Coli Ferric Uptake Regulator

Cat.No. : fur-4363E
Product Overview : Ferric Uptake Regulator Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 148 amino acids and having a molecular mass of 16 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Cat. No. : fur-4363E
Description : Ferric Uptake Regulator protein NCBI Accession No.: NP_415209 is a DNA-binding protein which controls iron-responsive genes. Ferric Uptake Regulator has a molecular mass of 17-kDa and plays a role in global transcriptional repressor that in the existence of iron regulates functions as diverse as iron acquisition, oxidative stress, and virulence. In Escherichia coli, members of the Ferric Uptake Regulator family regulate the expression of at least 100 genes that function in processes as diverse as the biosynthesis and transport of siderophores, the expression of virulence factors, the alleviation of oxidative and NO-induced stress, and the inhibition of ferritin production through the expression of RyhB.
Source : Escherichia Coli
Host : Escherichia Coli
Form : The Ferric Uptake Regulator protein solution contains 20mM Tris pH-8, 2mM CaCl2, and 100mM NaCl.
Purity : Greater than 90.0% as determined by (a) Analysis by RP-HPLC; (b) Analysis by SDS-PAGE.
Physical Appearance : Sterile Filtered colorless solution.
Amino Acid Sequence : MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYK RLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEG GKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQ REIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK.
Storage : Ferric Uptake Regulator although stable 4°C for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Functions : transcription repressor activity
Gene Name : fur DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol : fur
Synonyms : fur; ECs0714; Ferric uptake regulation protein; Ferric uptake regulator; Z0831; FUR; ECK0671; JW0669; b0683
Gene ID : 945295
Protein Refseq : NP_415209
UniProt ID : P0A9A9

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All fur Products

Required fields are marked with *

My Review for All fur Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends