Recombinant Full Length Human CD38 Protein
| Cat.No. : | CD38-58HF |
| Product Overview : | Recombinant full length Human CD38 with a N terminal proprietary tag: predicted molecular weight 59.11 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | CD38 is a novel multifunctional ectoenzyme widely expressed in cells and tissues especially in leukocytes. CD38 also functions in cell adhesion,signal transduction and calcium signaling. |
| Source : | In Vitro Cell Free System |
| Species : | Human |
| Form : | Liquid |
| Molecular Mass : | 59.110kDa inclusive of tags |
| Protein Length : | 300 amino acids |
| AA Sequence : | MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLA VVVPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHV DCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWC GEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA CDVVHAMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYR PDKFLQCVKNPEDSSCTSEI |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name : | CD38 CD38 molecule [ Homo sapiens ] |
| Official Symbol : | CD38 |
| Synonyms : | CD38; CD38 molecule; CD38 antigen (p45); ADP-ribosyl cyclase 1; ADP ribosyl cyclase 1; NAD(+) nucleosidase |
| Gene ID : | 952 |
| mRNA Refseq : | NM_001775 |
| Protein Refseq : | NP_001766 |
| MIM : | 107270 |
| UniProt ID : | P28907 |
Products Types
| ◆ Recombinant Protein | ||
| CD38-25H | Recombinant Human CD38 Protein, N-6His-Avi tagged, Biotinylated | +Inquiry |
| CD38-155H | Recombinant Human CD38 Protein, His-tagged | +Inquiry |
| Cd38-8742R | Active Recombinant Rat Cd38 protein(Trp45-Val303), hFc-tagged | +Inquiry |
| CD38-443H | Recombinant Human CD38 Protein (Va43-Ile300), His-tagged, Biotinylated | +Inquiry |
| CD38-1334M | Recombinant Mouse CD38 protein(Leu45-Thr304) | +Inquiry |
| ◆ Lysates | ||
| CD38-1025RCL | Recombinant Rabbit CD38 cell lysate | +Inquiry |
| CD38-1259RCL | Recombinant Rat CD38 cell lysate | +Inquiry |
| CD38-1398CCL | Recombinant Cynomolgus CD38 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
