Recombinant Full Length Human CD7 Protein
Cat.No. : | CD7-80HF |
Product Overview : | Recombinant full length mature Human CD7 with a N terminal proprietary tag; Predicted MWt 50.31 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 50.310kDa inclusive of tags |
Protein Length : | 220 amino acids |
AA Sequence : | PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLR QLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT MHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWH RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP AALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACV VYEDMSHSRCNTLSSPNQYQ |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | CD7 CD7 molecule [ Homo sapiens ] |
Official Symbol : | CD7 |
Synonyms : | CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41 |
Gene ID : | 924 |
mRNA Refseq : | NM_006137 |
Protein Refseq : | NP_006128 |
MIM : | 186820 |
UniProt ID : | P09564 |
Products Types
◆ Recombinant Protein | ||
CD7-175H | Recombinant Human CD7 Protein, C-His-tagged | +Inquiry |
Cd7-8761R | Recombinant Rat Cd7 protein(Met1-Pro149), hFc-tagged | +Inquiry |
CD7-0847H | Recombinant Human CD7 Protein, GST-Tagged | +Inquiry |
CD7-697H | Recombinant Human CD7 Protein, His-tagged | +Inquiry |
CD7-696H | Recombinant Human CD7 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
CD7-2607HCL | Recombinant Human CD7 cell lysate | +Inquiry |
CD7-1368RCL | Recombinant Rat CD7 cell lysate | +Inquiry |
CD7-2518MCL | Recombinant Mouse CD7 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket