Recombinant Full Length Human CD79B Protein

• Cat.No.: CD79B-66HF
• Product Overview: Recombinant full length Human CD79b with N terminal proprietary tag; Predicted MWt 50.60 kDa.

Specification

• Description: The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 50.600kDa inclusive of tags
• Protein Length: 229 amino acids
• AA Sequence: MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKG SACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQ EMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDG IIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLD IDQTATYEDIVTLRTGEVKWSVGEHPGQE
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens ]
• Official Symbol: CD79B
• Synonyms: CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29
• Gene ID: 974
• mRNA Refseq: NM_000626
• Protein Refseq: NP_000617
• MIM: 147245
• UniProt ID: P40259