Recombinant Full Length Human CHRNA7 Protein
Cat.No. : | CHRNA7-83HF |
Product Overview : | Recombinant Human full length Nicotinic Acetylcholine Receptor alpha 7 protein with a proprietary N-terminal tag; molecular weight 61.05 kDa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
Description : | The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from this gene and a novel FAM7A gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 61.050kDa inclusive of tags |
Protein Length : | 321 amino acids |
AA Sequence : | MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVT FTVTMRRRTLYYGLSLLIPCVLISALALLVFLLPADSGEK ISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTM ITVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAW FLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASN GNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLL HGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWK FAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDF A |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | CHRNA7 cholinergic receptor, nicotinic, alpha 7 [ Homo sapiens ] |
Official Symbol : | CHRNA7 |
Synonyms : | CHRNA7; cholinergic receptor, nicotinic, alpha 7; cholinergic receptor, nicotinic, alpha polypeptide 7; neuronal acetylcholine receptor subunit alpha-7 |
Gene ID : | 1139 |
mRNA Refseq : | NM_000746 |
Protein Refseq : | NP_000737 |
MIM : | 118511 |
UniProt ID : | P36544 |
Products Types
◆ Recombinant Protein | ||
CHRNA7-2674H | Recombinant Human CHRNA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA7-1283H | Recombinant Human CHRNA7 Protein, GST-Tagged | +Inquiry |
CHRNA7-1667M | Recombinant Mouse CHRNA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA7-527H | Recombinant Human CHRNA7 Protein, His/GST-tagged | +Inquiry |
CHRNA7-689R | Recombinant Rhesus Macaque CHRNA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CHRNA7-7514HCL | Recombinant Human CHRNA7 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CHRNA7 Products
Required fields are marked with *
My Review for All CHRNA7 Products
Required fields are marked with *
0
Inquiry Basket