Recombinant Full Length Human CKMT1A Protein
Cat.No. : | CKMT1A-85HF |
Product Overview : | Recombinant full length Human CKMT1B with N terminal proprietary tag; Predicted MWt 71.94 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 71.940kDa inclusive of tags |
Protein Length : | 417 amino acids |
AA Sequence : | MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAA SERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTT PTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAD LFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVL SSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKG DLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGM ARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMK RVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNL GTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDT AATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL ERGQDIRIPTPVIHTKH |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | CKMT1A creatine kinase, mitochondrial 1A [ Homo sapiens ] |
Official Symbol : | CKMT1A |
Synonyms : | CKMT1A; creatine kinase, mitochondrial 1A; CKMT1, creatine kinase, mitochondrial 1 (ubiquitous); creatine kinase U-type, mitochondrial |
Gene ID : | 548596 |
mRNA Refseq : | NM_001015001 |
Protein Refseq : | NP_001015001 |
MIM : | 613415 |
UniProt ID : | P12532 |
Products Types
◆ Recombinant Protein | ||
CKMT1A-27115TH | Recombinant Human CKMT1A | +Inquiry |
CKMT1A-27113TH | Recombinant Human CKMT1A | +Inquiry |
CKMT1A-324H | Recombinant Human CKMT1A Protein, His-tagged | +Inquiry |
CKMT1A-2155H | Recombinant Human CKMT1A Protein (Ser41-Ile250), His tagged | +Inquiry |
CKMT1A-5756C | Recombinant Chicken CKMT1A | +Inquiry |
◆ Lysates | ||
CKMT1A-001HCL | Recombinant Human CKMT1A cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CKMT1A Products
Required fields are marked with *
My Review for All CKMT1A Products
Required fields are marked with *
0
Inquiry Basket