Recombinant Full Length Human CNR2 Protein
Cat.No. : | CNR2-102HF |
Product Overview : | Recombinant full length Human Cannabinoid Receptor II with N terminal proprietary tag; Predicted MWt 65.67 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 65.670kDa inclusive of tags |
Protein Length : | 360 amino acids |
AA Sequence : | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLC TLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAG ADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFT ASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGI MWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLL FIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGM ARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLS DQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHH CLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDS RDLDLSDC |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | CNR2 cannabinoid receptor 2 (macrophage) [ Homo sapiens ] |
Official Symbol : | CNR2 |
Synonyms : | CNR2; cannabinoid receptor 2 (macrophage); cannabinoid receptor 2; CB2 |
Gene ID : | 1269 |
mRNA Refseq : | NM_001841 |
Protein Refseq : | NP_001832 |
MIM : | 605051 |
UniProt ID : | P34972 |
Products Types
◆ Recombinant Protein | ||
Cnr2-29R | Recombinant Rat Cnr2 Protein, His-tagged | +Inquiry |
CNR2-738H | Recombinant Human CNR2 protein(Met1-Cys360) | +Inquiry |
CNR2-1823M | Recombinant Mouse CNR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNR2-2703H | Recombinant Human CNR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNR2-12213Z | Recombinant Zebrafish CNR2 | +Inquiry |
◆ Lysates | ||
CNR2-7394HCL | Recombinant Human CNR2 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1181 | cAMP CNR2 (CB2) CHO-K1 GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket