Recombinant Full Length Human CTSZ Protein
Cat.No. : | CTSZ-101HF |
Product Overview : | Recombinant full length Human Cathepsin Z with a N terminal proprietary tag. Predicted MW 59.40kDa |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 59.400kDa inclusive of tags |
Protein Length : | 303 amino acids |
AA Sequence : | MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGD GLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASIT RNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSV QNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAK DQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGRE KMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYIN HVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY KDGKGARYNLAIEEHCTFGDPIV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | CTSZ cathepsin Z [ Homo sapiens ] |
Official Symbol : | CTSZ |
Synonyms : | CTSZ; cathepsin Z; CTSX |
Gene ID : | 1522 |
mRNA Refseq : | NM_001336 |
Protein Refseq : | NP_001327 |
MIM : | 603169 |
UniProt ID : | Q9UBR2 |
Products Types
◆ Recombinant Protein | ||
Ctsz-2371M | Recombinant Mouse Ctsz Protein, Myc/DDK-tagged | +Inquiry |
CTSZ-3386H | Recombinant Human CTSZ Protein, MYC/DDK-tagged | +Inquiry |
CTSZ-2120H | Recombinant Human CTSZ Protein, GST-tagged | +Inquiry |
CTSZ-4385H | Recombinant Human CTSZ Protein, His (Fc)-Avi-tagged | +Inquiry |
CTSZ-658H | Active Recombinant Human CTSZ Protein, His-tagged | +Inquiry |
◆ Lysates | ||
CTSZ-1603HCL | Recombinant Human CTSZ cell lysate | +Inquiry |
CTSZ-3020MCL | Recombinant Mouse CTSZ cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket