Recombinant Full Length Human DAD1 Protein
Cat.No. : | DAD1-120HF |
Product Overview : | Recombinant full length Human DAD1 with N terminal proprietary tag, 38.17 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line.The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis.DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 38.170kDa inclusive of tags |
Protein Length : | 113 amino acids |
AA Sequence : | MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGAL QFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQ NKADFQGISPERAFADFLFASTILHLVVMNFVG |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | DAD1 defender against cell death 1 [ Homo sapiens ] |
Official Symbol : | DAD1 |
Synonyms : | DAD1; defender against cell death 1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; oligosaccharyltransferase 2 homolog (S. cerevisiae); OST2 |
Gene ID : | 1603 |
mRNA Refseq : | NM_001344 |
Protein Refseq : | NP_001335 |
MIM : | 600243 |
UniProt ID : | P61803 |
Products Types
◆ Recombinant Protein | ||
DAD1-2324H | Recombinant Human DAD1 Protein, GST-tagged | +Inquiry |
DAD1-1427R | Recombinant Rat DAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DAD1-998R | Recombinant Rhesus Macaque DAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DAD1-5896Z | Recombinant Zebrafish DAD1 | +Inquiry |
DAD1-1739C | Recombinant Chicken DAD1 | +Inquiry |
◆ Lysates | ||
DAD1-215HCL | Recombinant Human DAD1 lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DAD1 Products
Required fields are marked with *
My Review for All DAD1 Products
Required fields are marked with *
0
Inquiry Basket