Recombinant Full Length Human DARC Protein
Cat.No. : | DARC-115HF |
Product Overview : | Recombinant full length Human DARC with N-Terminal proprietary Tag. Mol Wt 63.07 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 63.070kDa inclusive of tags |
Protein Length : | 336 amino acids |
AA Sequence : | MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGD YGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVL SMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGL GSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAG QVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYS TELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPG PWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQ ALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLP LPEGWFSHLDTLGSKS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | DARC Duffy blood group, chemokine receptor [ Homo sapiens ] |
Official Symbol : | DARC |
Synonyms : | DARC; Duffy blood group, chemokine receptor; Duffy blood group , FY; Duffy antigen/chemokine receptor; CCBP1; CD234; Dfy; GPD |
Gene ID : | 2532 |
mRNA Refseq : | NM_001122951 |
Protein Refseq : | NP_001116423 |
MIM : | 613665 |
UniProt ID : | Q16570 |
Products Types
◆ Recombinant Protein | ||
DARC-1312H | Recombinant Human DARC Protein, His-tagged | +Inquiry |
DARC-4582H | Recombinant Human DARC Protein, GST-tagged | +Inquiry |
DARC-26807H | Recombinant Human DARC Protein | +Inquiry |
DARC-26807TH | Recombinant Human DARC | +Inquiry |
◆ Assay kits | ||
Kit-1210 | DARC CHO-K1 β-Arrestin Orphan GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DARC Products
Required fields are marked with *
My Review for All DARC Products
Required fields are marked with *
0
Inquiry Basket