Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human DLX3 Protein

Cat.No. : DLX3-123HF
Product Overview : Recombinant full length Human DLX3 with N terminal proprietary tag, predicted mwt: 57.31 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 57.310kDa inclusive of tags
Protein Length : 287 amino acids
AA Sequence : MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDL GYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAY SPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVR MVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERA ELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPN NSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSAS PSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPP PNPGAVY
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : DLX3 distal-less homeobox 3 [ Homo sapiens ]
Official Symbol : DLX3
Synonyms : DLX3; distal-less homeobox 3; distal less homeo box 3; homeobox protein DLX-3
Gene ID : 1747
mRNA Refseq : NM_005220
Protein Refseq : NP_005211
MIM : 600525
UniProt ID : O60479

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DLX3 Products

Required fields are marked with *

My Review for All DLX3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends