Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human DNAJC3 Protein

Cat.No. : DNAJC3-124HF
Product Overview : Recombinant full length Human DNAJC3 with N-terminal proprietary tag, 51.85 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR).
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 51.850kDa inclusive of tags
Protein Length : 234 amino acids
AA Sequence : MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKH LELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATV FLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK LDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKK VTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSC LRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : DNAJC3 DnaJ (Hsp40) homolog, subfamily C, member 3 [ Homo sapiens ]
Official Symbol : DNAJC3
Synonyms : DNAJC3; DnaJ (Hsp40) homolog, subfamily C, member 3; PRKRI; dnaJ homolog subfamily C member 3; HP58; P58; P58IPK
Gene ID : 5611
mRNA Refseq : NM_006260
Protein Refseq : NP_006251
MIM : 601184
UniProt ID : Q13217

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DNAJC3 Products

Required fields are marked with *

My Review for All DNAJC3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends