Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human DOCK1 Protein

Cat.No. : DOCK1-126HF
Product Overview : Recombinant full length Human DOCK1 with N-terminal proprietary tag, 42.79 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 42.790kDa inclusive of tags
Protein Length : 152 amino acids
AA Sequence : MRIGRQSCKIHNYAINNGLFFKCMISPPSGDVRNDIYVTL VQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGD EAISEYKSVIYYQVKQPRWFETVKVLFTWSFYHMALIMKC SFVTQGNILTSSSARELLQAGRVSPNKVIQGC
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ]
Official Symbol : DOCK1
Synonyms : DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK
Gene ID : 1793
mRNA Refseq : NM_001380
Protein Refseq : NP_001371
MIM : 601403
UniProt ID : Q14185

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DOCK1 Products

Required fields are marked with *

My Review for All DOCK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends