Recombinant Full Length Human EFNA3 Protein
Cat.No. : | EFNA3-140HF |
Product Overview : | Recombinant full length Human Ephrin A3 with N terminal proprietary tag; Predicted MWt 51.92 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 51.920kDa inclusive of tags |
Protein Length : | 238 amino acids |
AA Sequence : | MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSS NQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPG GGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLR MKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEG ENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | EFNA3 ephrin-A3 [ Homo sapiens ] |
Official Symbol : | EFNA3 |
Synonyms : | EFNA3; ephrin-A3; EPLG3; Ehk1 L; LERK3 |
Gene ID : | 1944 |
mRNA Refseq : | NM_004952 |
Protein Refseq : | NP_004943 |
MIM : | 601381 |
UniProt ID : | P52797 |
Products Types
◆ Recombinant Protein | ||
EFNA3-182H | Recombinant Human EFNA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EFNA3-160H | Active Recombinant Human/Cynomolgus EFNA3 protein(Gln23-Ser213), hFc-tagged | +Inquiry |
EFNA3-231H | Recombinant Human EFNA3 Protein, Fc-tagged | +Inquiry |
Efna3-28M | Recombinant Mouse Efna3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EFNA3-3099H | Recombinant Human EFNA3 Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
EFNA3-2437HCL | Recombinant Human EFNA3 cell lysate | +Inquiry |
EFNA3-2160MCL | Recombinant Mouse EFNA3 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket