Recombinant Full Length Human EMP3 Protein
Cat.No. : | EMP3-153HF |
Product Overview : | Recombinant full length Human EMP3 with N-terminal proprietary tag. Predicted MW 43.67 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Epithelial membrane protein 3 is a protein that in humans is encoded by the EMP3 gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 43.670kDa inclusive of tags |
Protein Length : | 163 amino acids |
AA Sequence : | MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLW YDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLS FILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAI HAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLR KRE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | EMP3 epithelial membrane protein 3 [ Homo sapiens ] |
Official Symbol : | EMP3 |
Synonyms : | EMP3; epithelial membrane protein 3; YMP |
Gene ID : | 2014 |
mRNA Refseq : | NM_001425 |
Protein Refseq : | NP_001416 |
MIM : | 602335 |
UniProt ID : | P54852 |
Products Types
◆ Recombinant Protein | ||
EMP3-3288H | Recombinant Human EMP3 Protein, GST-tagged | +Inquiry |
EMP3-1753R | Recombinant Rat EMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EMP3-2780M | Recombinant Mouse EMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EMP3-1292R | Recombinant Rhesus Macaque EMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Emp3-2817M | Recombinant Mouse Emp3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
EMP3-6605HCL | Recombinant Human EMP3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket