Recombinant Full Length Human EPHA7 Protein
Cat.No. : | EPHA7-154HF |
Product Overview : | Recombinant full length Human Eph receptor A7 with an N terminal proprietary tag; Predicted MWt 56.32 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 56.320kDa inclusive of tags |
Protein Length : | 279 amino acids |
AA Sequence : | MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKA QQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPN QNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK ETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDL GERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKV YYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE EAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | EPHA7 EPH receptor A7 [ Homo sapiens ] |
Official Symbol : | EPHA7 |
Synonyms : | EPHA7; EPH receptor A7; EphA7; ephrin type-A receptor 7; Hek11 |
Gene ID : | 2045 |
mRNA Refseq : | NM_004440 |
Protein Refseq : | NP_004431 |
MIM : | 602190 |
UniProt ID : | Q15375 |
Products Types
◆ Recombinant Protein | ||
EPHA7-3393H | Active Recombinant Human EPHA7 Protein, GST-tagged | +Inquiry |
EPHA7-68H | Recombinant Human EPHA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPHA7-226H | Recombinant Human EPHA7 Protein, His-tagged | +Inquiry |
EPHA7-3394H | Recombinant Human EPHA7 Protein, GST-tagged | +Inquiry |
Epha7-956M | Recombinant Mouse Epha7 Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
EPHA7-414HCL | Recombinant Human EPHA7 cell lysate | +Inquiry |
EPHA7-2125MCL | Recombinant Mouse EPHA7 cell lysate | +Inquiry |
EPHA7-2236HCL | Recombinant Human EPHA7 cell lysate | +Inquiry |
◆ Assay kits | ||
Kit-1554 | U2OS EphA7 Bioassay Kit | +Inquiry |
Kit-1581 | EphA7 Functional Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket