Recombinant Full Length Human GAGE1 Protein

• Cat.No.: GAGE1-189HF
• Product Overview: Recombinant full length Human GAGE1 (amino acids 1-138) with N terminal proprietary tag, 41.36kDa.

Specification

• Description: This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. Alternative splicing results in multiple transcript variants.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 41.360kDa inclusive of tags
• Protein Length: 138 amino acids
• AA Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPAT PEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQG HPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQT GILWLLMNNCFLNLSPRKP
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: GAGE1 G antigen 1 [ Homo sapiens ]
• Official Symbol: GAGE1
• Synonyms: GAGE1; G antigen 1; cancer/testis antigen family 4; member 1; CT4.1
• Gene ID: 2543
• mRNA Refseq: NM_001040663
• Protein Refseq: NP_001035753
• MIM: 300594
• UniProt ID: Q13065