Recombinant Full Length Human GFER Protein

• Cat.No.: GFER-190HF
• Product Overview: Recombinant full length Human ALR isoform 2 with N-terminal proprietary tag.Mol Wt 39.86 kDa inclusive of tag.

Specification

• Description: The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 39.860kDa inclusive of tags
• Protein Length: 125 amino acids
• AA Sequence: MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDL PTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDT RTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWK DGSCD
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: GFER growth factor, augmenter of liver regeneration [ Homo sapiens ]
• Official Symbol: GFER
• Synonyms: GFER; growth factor, augmenter of liver regeneration; growth factor, erv1 (S. cerevisiae) like (augmenter of liver regeneration); FAD-linked sulfhydryl oxidase ALR; ALR; ERV1; ERV1 homolog (S. cerevisiae); HERV1; HPO1; HPO2; HSS
• Gene ID: 2671
• mRNA Refseq: NM_005262
• Protein Refseq: NP_005253
• MIM: 600924
• UniProt ID: P55789