Recombinant Full Length Human GM2A Protein

• Cat.No.: GM2A-199HF
• Product Overview: Recombinant full length Human GM2A with N terminal proprietary tag. Predicted MW 47.3 kDa

Specification

• Description: This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 47.300kDa inclusive of tags
• Protein Length: 193 amino acids
• AA Sequence: MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCD EGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPL KVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIP TGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELP SWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: GM2A GM2 ganglioside activator [ Homo sapiens ]
• Official Symbol: GM2A
• Synonyms: GM2A; GM2 ganglioside activator; GM2 ganglioside activator protein; ganglioside GM2 activator; cerebroside sulfate activator protein; SAP 3; sphingolipid activator protein 3
• Gene ID: 2760
• mRNA Refseq: NM_000405
• Protein Refseq: NP_000396
• MIM: 613109
• UniProt ID: P17900