Recombinant Full Length Human GRIN2C Protein, Protein A-tagged

• Cat.No.: GRIN2C-208HF
• Product Overview: Recombinant full length Human NMDAR2C according to Protein Accession AAH59384.1, with a N terminal proprietary tag: predicted molecular weight 44.88 kDa inclusive of tag.

Specification

• Description: N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D).
• Source: In Vitro Cell Free System
• Species: Human
• Tag: Protein A
• Form: Liquid
• Molecular Mass: 44.880kDa inclusive of tags
• Protein Length: 171 amino acids
• AA Sequence: MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSG PPQAQFRARLTPQSFLDLPLEIQPLTVGVNTTNPSSLLTQ ICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPIL SISGGSAVVLTPKVHVQTHVPSCLRPGTRLGSGVLWFWEA GIRRDGQGGGG
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: GRIN2C glutamate receptor, ionotropic, N-methyl D-aspartate 2C [ Homo sapiens ]
• Official Symbol: GRIN2C
• Synonyms: GRIN2C; glutamate receptor, ionotropic, N-methyl D-aspartate 2C; NMDAR2C; glutamate [NMDA] receptor subunit epsilon-3
• Gene ID: 2905
• mRNA Refseq: NM_000835
• Protein Refseq: NP_000826
• MIM: 138254
• UniProt ID: Q14957