Recombinant Full Length Human ID4 Protein

• Cat.No.: ID4-248HF
• Product Overview: Recombinant full length Human ID4 with N terminal proprietary tag; Predicted MWt 43.78 kDa inclusive of tag.

Specification

• Description: Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 43.780kDa inclusive of tags
• Protein Length: 161 amino acids
• AA Sequence: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAA AAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVP TIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILC R
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: ID4 inhibitor of DNA binding 4, dominant negative helix-loop-helix protein [ Homo sapiens ]
• Official Symbol: ID4
• Synonyms: ID4; inhibitor of DNA binding 4, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-4; bHLHb27
• Gene ID: 3400
• mRNA Refseq: NM_001546
• Protein Refseq: NP_001537
• MIM: 600581
• UniProt ID: P47928