Recombinant Full Length Human IDH3A Protein
Cat.No. : | IDH3A-251HF |
Product Overview : | Recombinant full length Human IDH3A with N-terminal proprietary tag. Mol Wt 66 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 66.000kDa |
Protein Length : | 366 amino acids |
AA Sequence : | MAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGD GIGPEISAAVMKIFDAAKAPIQWEERNVTAIQGPGGKWMI PSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDL YANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSGIEHVI VDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHK ANIMRMSDGLFLQKCREVAESCKDIKFNEMYLDTVCLNMV QDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGA NGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGL FDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICR RVKDLD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | IDH3A isocitrate dehydrogenase 3 (NAD+) alpha [ Homo sapiens ] |
Official Symbol : | IDH3A |
Synonyms : | IDH3A; isocitrate dehydrogenase 3 (NAD+) alpha; isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial; H IDH alpha; isocitrate dehydrogenase (NAD+) alpha chain; isocitrate dehydrogenase [NAD] subunit alpha; mitochondrial; isocitric dehydrogenase; NA |
Gene ID : | 3419 |
mRNA Refseq : | NM_005530 |
Protein Refseq : | NP_005521 |
MIM : | 601149 |
UniProt ID : | P50213 |
Products Types
◆ Recombinant Protein | ||
IDH3A-2642R | Recombinant Rat IDH3A Protein, His (Fc)-Avi-tagged | +Inquiry |
IDH3A-2014R | Recombinant Rhesus Macaque IDH3A Protein, His (Fc)-Avi-tagged | +Inquiry |
Idh3a-3473M | Recombinant Mouse Idh3a Protein, Myc/DDK-tagged | +Inquiry |
IDH3A-1136H | Recombinant Human IDH3A Protein, His (Fc)-Avi-tagged | +Inquiry |
IDH3A-4411M | Recombinant Mouse IDH3A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
IDH3A-5305HCL | Recombinant Human IDH3A 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket