Recombinant Full Length Human IFI35 Protein
Cat.No. : | IFI35-249HF |
Product Overview : | Recombinant full length Human IFI35 with N-terminal proprietary tag. Predicted MW 57.75kDa. |
- Specification
- Gene Information
- Related Products
Description : | Enables identical protein binding activity. Involved in several processes, including macrophage activation involved in immune response; positive regulation of defense response; and regulation of signal transduction. Located in several cellular components, including cytosol; extracellular space; and nucleus. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 57.750kDa inclusive of tags |
Protein Length : | 288 amino acids |
AA Sequence : | MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDK VPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGS ALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPM VTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIF FGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQF TVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNI PDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGL AVFTSESG |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | IFI35 interferon-induced protein 35 [ Homo sapiens ] |
Official Symbol : | IFI35 |
Synonyms : | IFI35; interferon-induced protein 35; interferon-induced 35 kDa protein; IFP35 |
Gene ID : | 3430 |
mRNA Refseq : | NM_005533 |
Protein Refseq : | NP_005524 |
MIM : | 600735 |
UniProt ID : | P80217 |
Products Types
◆ Recombinant Protein | ||
Ifi35-3477M | Recombinant Mouse Ifi35 Protein, Myc/DDK-tagged | +Inquiry |
IFI35-2020R | Recombinant Rhesus Macaque IFI35 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFI35-1142H | Recombinant Human IFI35 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFI35-1860H | Recombinant Human IFI35 protein, His & T7-tagged | +Inquiry |
IFI35-2199R | Recombinant Rhesus monkey IFI35 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
IFI35-5293HCL | Recombinant Human IFI35 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket