Recombinant Full Length Human IKBKB Protein
Cat.No. : | IKBKB-255HF |
Product Overview : | Recombinant full length Human IKK beta with N terminal proprietary tag, 53.79kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 53.790kDa inclusive of tags |
Protein Length : | 256 amino acids |
AA Sequence : | MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQ IAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVP EGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRL IHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYT VTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVA HSCNPSTLGGRGRWIS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | IKBKB inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta [ Homo sapiens ] |
Official Symbol : | IKBKB |
Synonyms : | IKBKB; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta; inhibitor of nuclear factor kappa-B kinase subunit beta; IKK beta; IKK2; IKKB; NFKBIKB |
Gene ID : | 3551 |
mRNA Refseq : | NM_001190720 |
Protein Refseq : | NP_001177649 |
MIM : | 603258 |
UniProt ID : | O14920 |
Products Types
◆ Recombinant Protein | ||
IKBKB-501H | Recombinant Human IKBKB Protein, MYC/DDK-tagged | +Inquiry |
IKBKB-2046R | Recombinant Rhesus Macaque IKBKB Protein, His (Fc)-Avi-tagged | +Inquiry |
Ikbkb-1232M | Recombinant Mouse Ikbkb Protein, MYC/DDK-tagged | +Inquiry |
IKBKB-1065H | Recombinant Human IKBKB Protein (S695-S756), GST tagged | +Inquiry |
IKBKB-1162H | Recombinant Human IKBKB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
IKBKB-849HCL | Recombinant Human IKBKB cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket