Recombinant Full Length Human LFNG Protein
Cat.No. : | LFNG-286HF |
Product Overview : | Recombinant full length Human Lunatic Fringe, isoform 2 with N terminal proprietary tag; Predicted MW 53.24 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene is a member of the fringe gene family which also includes radical and manic fringe genes. They all encode evolutionarily conserved glycosyltransferases that act in the Notch signaling pathway to define boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. This gene product is predicted to be a single-pass type II Golgi membrane protein but it may also be secreted and proteolytically processed like the related proteins in mouse and Drosophila (PMID: 9187150). Mutations in this gene have been associated with autosomal recessive spondylocostal dysostosis 3. Multiple transcript variants encoding different isoforms have been found for this gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 53.240kDa inclusive of tags |
Protein Length : | 250 amino acids |
AA Sequence : | MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNCS AAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRA LLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVH FWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPD DCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQ VTLSYGMFENKRNAVHVKGPFSVEADPSRFRSIHCHLYPD TPWCPRTAIF |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | LFNG LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase [ Homo sapiens ] |
Official Symbol : | LFNG |
Synonyms : | LFNG; LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase; lunatic fringe (Drosophila) homolog , lunatic fringe homolog (Drosophila); beta-1,3-N-acetylglucosaminyltransferase lunatic fringe; SCDO3 |
Gene ID : | 3955 |
mRNA Refseq : | NM_001040167 |
Protein Refseq : | NP_001035257 |
MIM : | 602576 |
UniProt ID : | Q8NES3 |
Products Types
◆ Recombinant Protein | ||
LFNG-2140H | Recombinant Human LFNG Protein (1-250 aa), GST-tagged | +Inquiry |
LFNG-3040R | Recombinant Rat LFNG Protein, His (Fc)-Avi-tagged | +Inquiry |
LFNG-6508C | Recombinant Chicken LFNG | +Inquiry |
LFNG-8607Z | Recombinant Zebrafish LFNG | +Inquiry |
LFNG-29854TH | Recombinant Human LFNG | +Inquiry |
◆ Lysates | ||
LFNG-983HCL | Recombinant Human LFNG cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All LFNG Products
Required fields are marked with *
My Review for All LFNG Products
Required fields are marked with *
0
Inquiry Basket