Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human MAGEA6 Protein

Cat.No. : MAGEA6-296HF
Product Overview : Recombinant full length Human MAGEA6 with a N terminal proprietary tag; Predicted MWt 60.61 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding the same protein have been identified for this gene.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 60.610kDa inclusive of tags
Protein Length : 314 amino acids
AA Sequence : MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAAS SSSTLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLW SQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFL LLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASDSLQL VFGIELMEVDPIGHVYIFATCLGLSYDGLLGDNQIMPKTG FLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFG DPKKLLTQYFVQENYLEYRQVPGSDPACYEFLWGPRALIE TSYVKVLHHMVKISGGPRISYPLLHEWALREGEE
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : MAGEA6 melanoma antigen family A, 6 [ Homo sapiens ]
Official Symbol : MAGEA6
Synonyms : MAGEA6; melanoma antigen family A, 6; MAGE6; melanoma-associated antigen 6; cancer/testis antigen family 1; member 6; CT1.6; MAGE 6 antigen; melanoma antigen family A 6; melanoma associated antigen 6
Gene ID : 4105
mRNA Refseq : NM_005363
Protein Refseq : NP_005354
MIM : 300176
UniProt ID : P43360

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All MAGEA6 Products

Required fields are marked with *

My Review for All MAGEA6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends