Recombinant Full Length Human MLANA Protein
Cat.No. : | MLANA-308HF |
Product Overview : | Recombinant full length Human MelanA with N terminal proprietary tag; Predicted MWt 39.09 kDa. |
- Specification
- Gene Information
- Related Products
Description : | MART-1 / Melan-A is a protein antigen found on melanocytes. Antibodies against the antigen are used in the medical specialty of anatomic pathology in order to recognize cells of melanocytic differentiation, useful for the diagnosis of a melanoma. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 39.090kDa inclusive of tags |
Protein Length : | 118 amino acids |
AA Sequence : | MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVL LLIGCWYCRRRNGYRALMDKSLHVGTQCALTRRCPQEGFD HRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | MLANA melan-A [ Homo sapiens ] |
Official Symbol : | MLANA |
Synonyms : | MLANA; melan-A; melanoma antigen recognized by T-cells 1; MART1 |
Gene ID : | 2315 |
mRNA Refseq : | NM_005511 |
Protein Refseq : | NP_005502 |
MIM : | 605513 |
UniProt ID : | Q16655 |
Products Types
◆ Recombinant Protein | ||
MLANA-5379H | Recombinant Human MLANA Protein, GST-tagged | +Inquiry |
MLANA-1282H | Recombinant Human MLANA Protein, His-B2M-tagged | +Inquiry |
MLANA-1417H | Recombinant Human MLANA Protein, His (Fc)-Avi-tagged | +Inquiry |
MLANA-585H | Recombinant Human MLANA Protein, MYC/DDK-tagged | +Inquiry |
Mlana-4088M | Recombinant Mouse Mlana Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
MLANA-411HCL | Recombinant Human MLANA lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket